(data stored in ACNUC5340 zone)

EMBL: CP000828.PE653

CP000828.PE653       Location/Qualifiers
FT   CDS             680053..680820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0698"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25744"
FT                   /db_xref="GOA:B0CEB0"
FT                   /db_xref="InterPro:IPR032801"
FT                   /db_xref="UniProtKB/TrEMBL:B0CEB0"
FT                   /protein_id="ABW25744.1"
FT                   /translation="MDTYAIFKQTQSQRVSDGAVVPLLSNCEKASLTLVLVWPQLGDFD
FT                   SLEYAWWLQRQAKQIQAKGVQIRAVGIGDLNSGQKFCDFTGFPAKHLFIDATGQLHQQL
FT                   NLYPGLTWKVPFLSPLQNAYLNLLLMCAGIGSPGTLVEVFRGYRGDRNAPQLIAEDEEV
FT                   RAFPLPPVNGALFNRAGGKGFQRPFELATLRLRNMAEVLKYWKTYVPDATYITQRGGTF
FT                   LFDQQGQLVYEHRDRGILGFAANMSNPLAFLLK"
     MDTYAIFKQT QSQRVSDGAV VPLLSNCEKA SLTLVLVWPQ LGDFDSLEYA WWLQRQAKQI        60
     QAKGVQIRAV GIGDLNSGQK FCDFTGFPAK HLFIDATGQL HQQLNLYPGL TWKVPFLSPL       120
     QNAYLNLLLM CAGIGSPGTL VEVFRGYRGD RNAPQLIAED EEVRAFPLPP VNGALFNRAG       180
     GKGFQRPFEL ATLRLRNMAE VLKYWKTYVP DATYITQRGG TFLFDQQGQL VYEHRDRGIL       240
     GFAANMSNPL AFLLK                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page