(data stored in ACNUC5340 zone)

EMBL: CP000828.PE655

CP000828.PE655       Location/Qualifiers
FT   CDS             681631..682767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0700"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25746"
FT                   /db_xref="GOA:B0CEB2"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:B0CEB2"
FT                   /protein_id="ABW25746.1"
FT                   /translation="MQVARLKQQVLFSLIGLSTLLGSPPFSAVSQEPRPTQLGKQLQQQ
FT                   VQDCVGNSPTAKTSTQRYQTCITQLILLDAKGNRRPDASQRLLALFEAMGIAIPKRQRQ
FT                   GQTTLALESLPRSNCFSLPVQIKGYTGQFLLDTGATHTVINTTLGEQLGLPLQDYPSNL
FT                   TQGLAFGNERKTQVGIYPALTLSIKDASVQQIHPLGMAKQSILHDLSGILGLDFLSQFD
FT                   MVIDPQQRQIQLLPPTSPTEGIPLTGKGGWLTVQVLINGQGPFTFALDTGATQTILSPQ
FT                   VAAQLALSPTAKPVQLQGLLGIEAAQPIQLDTVQIGPHQTTQLDALIIASPLIDRMQVD
FT                   GLIGQNFLNQYQQHWRFGPQNALGMVEQGTLNLSPLKR"
     MQVARLKQQV LFSLIGLSTL LGSPPFSAVS QEPRPTQLGK QLQQQVQDCV GNSPTAKTST        60
     QRYQTCITQL ILLDAKGNRR PDASQRLLAL FEAMGIAIPK RQRQGQTTLA LESLPRSNCF       120
     SLPVQIKGYT GQFLLDTGAT HTVINTTLGE QLGLPLQDYP SNLTQGLAFG NERKTQVGIY       180
     PALTLSIKDA SVQQIHPLGM AKQSILHDLS GILGLDFLSQ FDMVIDPQQR QIQLLPPTSP       240
     TEGIPLTGKG GWLTVQVLIN GQGPFTFALD TGATQTILSP QVAAQLALSP TAKPVQLQGL       300
     LGIEAAQPIQ LDTVQIGPHQ TTQLDALIIA SPLIDRMQVD GLIGQNFLNQ YQQHWRFGPQ       360
     NALGMVEQGT LNLSPLKR                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page