(data stored in ACNUC8465 zone)

EMBL: CP000828.PE66

CP000828.PE66        Location/Qualifiers
FT   CDS             70390..71421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0069"
FT                   /product="diguanylate cyclase (GGDEF domain)"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25157"
FT                   /db_xref="GOA:B0C545"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B0C545"
FT                   /protein_id="ABW25157.1"
FT                   /translation="MPDSPKPSNILIVDDVPTNLTILAQTLRDQGFTVWVATSGNAALK
FT                   QLAHGLPDLILLDIQMPGMNGLETCAKLKADLRTQDIPVIFMSALSEQANKVEGLSLGA
FT                   VDYITKPFQEAEVLARVKVHLSIRELTQNLQREIEERKRVEAELAKANASLHRLAHIDG
FT                   LTQVANRYRFDQDMEQVWRRLQRDHEPLSLILCDVDYFKLFNDHYGHQVGDDCLRQVAL
FT                   AIQKAVHRPDDLVARYGGEEFAIVLPSTHAQGAEQVALGILSKIAELNIPHEFSTVSPQ
FT                   ITLSLGIATVIPKSEQSLDGLIELTDKALYRAKEEGRNTYCHHDCSQSPPSLSCSPSPL
FT                   SLH"
     MPDSPKPSNI LIVDDVPTNL TILAQTLRDQ GFTVWVATSG NAALKQLAHG LPDLILLDIQ        60
     MPGMNGLETC AKLKADLRTQ DIPVIFMSAL SEQANKVEGL SLGAVDYITK PFQEAEVLAR       120
     VKVHLSIREL TQNLQREIEE RKRVEAELAK ANASLHRLAH IDGLTQVANR YRFDQDMEQV       180
     WRRLQRDHEP LSLILCDVDY FKLFNDHYGH QVGDDCLRQV ALAIQKAVHR PDDLVARYGG       240
     EEFAIVLPST HAQGAEQVAL GILSKIAELN IPHEFSTVSP QITLSLGIAT VIPKSEQSLD       300
     GLIELTDKAL YRAKEEGRNT YCHHDCSQSP PSLSCSPSPL SLH                         343
//

If you have problems or comments...

PBIL Back to PBIL home page