(data stored in ACNUC27125 zone)

EMBL: CP000828.PE668

CP000828.PE668       Location/Qualifiers
FT   CDS             complement(693681..694838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0713"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25759"
FT                   /db_xref="GOA:B0CEC5"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:B0CEC5"
FT                   /protein_id="ABW25759.1"
FT                   /translation="MVQHMNSVELLVDADAFWHRLQNDLQAADHEIMLQMMTFEGDRTG
FT                   QQVIEAMLASEAPCKQILVDNYTRFIQSDKFIYHPKYWSDQDLKTEVRQTHAMFEALIQ
FT                   EGGQVRFTNPVGPFLIHFVGRSHKKLIVIDNQIAYIGGFNFSDHNFAWHDLMFRLEDPA
FT                   IVEFLRADFMATWQDQSQPSHADFGDCEFFLLNGRTNEATFAILLDLLCSAQKSLHIIS
FT                   PYLTFPFCAALAELPQRGVPVTLLTPEGNNKGTVRDYLLWEAQRSGFDVRLYDGMSHMK
FT                   AALVDDRYLVVGSSNFDFLSYRIEEEVLAIFSNPTVIETFRQQVLEPDLARCRPFDGQA
FT                   SALRGWLSYGILRAVETLALFSRRIKSTQVIDTAVRGYPVMPKES"
     MVQHMNSVEL LVDADAFWHR LQNDLQAADH EIMLQMMTFE GDRTGQQVIE AMLASEAPCK        60
     QILVDNYTRF IQSDKFIYHP KYWSDQDLKT EVRQTHAMFE ALIQEGGQVR FTNPVGPFLI       120
     HFVGRSHKKL IVIDNQIAYI GGFNFSDHNF AWHDLMFRLE DPAIVEFLRA DFMATWQDQS       180
     QPSHADFGDC EFFLLNGRTN EATFAILLDL LCSAQKSLHI ISPYLTFPFC AALAELPQRG       240
     VPVTLLTPEG NNKGTVRDYL LWEAQRSGFD VRLYDGMSHM KAALVDDRYL VVGSSNFDFL       300
     SYRIEEEVLA IFSNPTVIET FRQQVLEPDL ARCRPFDGQA SALRGWLSYG ILRAVETLAL       360
     FSRRIKSTQV IDTAVRGYPV MPKES                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page