(data stored in ACNUC27125 zone)

EMBL: CP000828.PE67

CP000828.PE67        Location/Qualifiers
FT   CDS             71535..71972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25158"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:B0C546"
FT                   /protein_id="ABW25158.1"
FT                   /translation="MVIVHEILDLETDQGIGIYNLSPQIQEFIAASSIRNGQVLICSRH
FT                   TTTSLAINEYEERLLEDIKVYLHKLAPANQRYLHNDLHLRDVPEDEPENAHSHLMAITL
FT                   SSSEVAPIVEGQLALGTYQSVLLFELDGPRQRTVFLQLSGE"
     MVIVHEILDL ETDQGIGIYN LSPQIQEFIA ASSIRNGQVL ICSRHTTTSL AINEYEERLL        60
     EDIKVYLHKL APANQRYLHN DLHLRDVPED EPENAHSHLM AITLSSSEVA PIVEGQLALG       120
     TYQSVLLFEL DGPRQRTVFL QLSGE                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page