(data stored in ACNUC27125 zone)

EMBL: CP000828.PE673

CP000828.PE673       Location/Qualifiers
FT   CDS             complement(701681..701887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0718"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25764"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="UniProtKB/TrEMBL:B0CED0"
FT                   /protein_id="ABW25764.1"
FT                   /translation="MREQQTQHHRIRGTTPAVVAAARRLRLNLTTAEQKLWKALQKRQL
FT                   SGLKFRCQRAVRSLSIFTVLNAD"
     MREQQTQHHR IRGTTPAVVA AARRLRLNLT TAEQKLWKAL QKRQLSGLKF RCQRAVRSLS        60
     IFTVLNAD                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page