(data stored in ACNUC5340 zone)

EMBL: CP000828.PE674

CP000828.PE674       Location/Qualifiers
FT   CDS             complement(702061..703074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0719"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25765"
FT                   /db_xref="GOA:B0CED1"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:B0CED1"
FT                   /protein_id="ABW25765.1"
FT                   /translation="MNKFWHKKTFVRLLMLFCVGLGLTFLFQKINLQGRDLLEAFQRFS
FT                   PEALVLMLGVTLVQMVFQVTRLWVLCPQAAGVSWAQAANTYVSGQFIGNFVLSQAGHAV
FT                   KIALLRKDKDAKGRKIDAAEATAVILVDKVLDVGILVTLAVLSALQVSVGLPQVDWWEK
FT                   GIIVLIGVPFLGIALWALQRSLRQRFPKLRQWLRKFKVGLAVIRNPLQIRNAAVMDLGD
FT                   WFTECLLLQLLCMAQGHVLSLPQLLICLFILNLGLTVPTTMANLGTYEAALAFSLNGMG
FT                   VPLAQSVVIATMFHAYQLFGLPVWMFIQKLSVRFSPKLNSAVPIPVTPERSKVTSK"
     MNKFWHKKTF VRLLMLFCVG LGLTFLFQKI NLQGRDLLEA FQRFSPEALV LMLGVTLVQM        60
     VFQVTRLWVL CPQAAGVSWA QAANTYVSGQ FIGNFVLSQA GHAVKIALLR KDKDAKGRKI       120
     DAAEATAVIL VDKVLDVGIL VTLAVLSALQ VSVGLPQVDW WEKGIIVLIG VPFLGIALWA       180
     LQRSLRQRFP KLRQWLRKFK VGLAVIRNPL QIRNAAVMDL GDWFTECLLL QLLCMAQGHV       240
     LSLPQLLICL FILNLGLTVP TTMANLGTYE AALAFSLNGM GVPLAQSVVI ATMFHAYQLF       300
     GLPVWMFIQK LSVRFSPKLN SAVPIPVTPE RSKVTSK                                337
//

If you have problems or comments...

PBIL Back to PBIL home page