(data stored in ACNUC8465 zone)

EMBL: CP000828.PE687

CP000828.PE687       Location/Qualifiers
FT   CDS             716590..716874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0732"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25778"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:B0CF91"
FT                   /protein_id="ABW25778.1"
FT                   /translation="MAQAVWNGVVVAESNQCEVVEGNQYFPPDAIKSDYFKASDTHTTC
FT                   PWKGVASYYSLEVDGQVNKDAAWYYPDPKDAAKNIKGYIAFWKGVQVTA"
     MAQAVWNGVV VAESNQCEVV EGNQYFPPDA IKSDYFKASD THTTCPWKGV ASYYSLEVDG        60
     QVNKDAAWYY PDPKDAAKNI KGYIAFWKGV QVTA                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page