(data stored in ACNUC5340 zone)

EMBL: CP000828.PE689

CP000828.PE689       Location/Qualifiers
FT   CDS             complement(717313..717543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0734"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25780"
FT                   /db_xref="UniProtKB/TrEMBL:B0CF93"
FT                   /protein_id="ABW25780.1"
FT                   /translation="MQPITTVEAALQKIDTFSGEAAEFQLPISESLMDNIGINMAIITD
FT                   RILAKGWTPNGFQQEEGYRVYSYRDLNGFGC"
     MQPITTVEAA LQKIDTFSGE AAEFQLPISE SLMDNIGINM AIITDRILAK GWTPNGFQQE        60
     EGYRVYSYRD LNGFGC                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page