(data stored in ACNUC27125 zone)

EMBL: CP000828.PE69

CP000828.PE69        Location/Qualifiers
FT   CDS             73482..73811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25160"
FT                   /db_xref="UniProtKB/TrEMBL:B0C548"
FT                   /protein_id="ABW25160.1"
FT                   /translation="MNKKLAVLTAIFASSISTAVSAQIAQVSNIRPLDKPGLYMASGVL
FT                   QYPDGDALQADFRVYCPTSMIRPTNYQLFDKLGHAKQQGSWWQTAFQPKYASEFTLIRS
FT                   VCGGD"
     MNKKLAVLTA IFASSISTAV SAQIAQVSNI RPLDKPGLYM ASGVLQYPDG DALQADFRVY        60
     CPTSMIRPTN YQLFDKLGHA KQQGSWWQTA FQPKYASEFT LIRSVCGGD                   109
//

If you have problems or comments...

PBIL Back to PBIL home page