(data stored in ACNUC5340 zone)

EMBL: CP000828.PE690

CP000828.PE690       Location/Qualifiers
FT   CDS             complement(717582..717755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25781"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B0CF94"
FT                   /protein_id="ABW25781.1"
FT                   /translation="MQEFDSATNDVSFAFHNGFGFEMVGVQKEVGHVADRWQDVAIMQL
FT                   ILPQVPPYPTGA"
     MQEFDSATND VSFAFHNGFG FEMVGVQKEV GHVADRWQDV AIMQLILPQV PPYPTGA           57
//

If you have problems or comments...

PBIL Back to PBIL home page