(data stored in ACNUC8465 zone)

EMBL: CP000828.PE692

CP000828.PE692       Location/Qualifiers
FT   CDS             717878..718111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0737"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25783"
FT                   /db_xref="UniProtKB/TrEMBL:B0CF96"
FT                   /protein_id="ABW25783.1"
FT                   /translation="MYNLQLLEFIEAIQETHDLEELKQIRRRVCSILQAVVIDLDKDRI
FT                   SAESFWSFTMPWEVAITTLRHRETILLKVHLN"
     MYNLQLLEFI EAIQETHDLE ELKQIRRRVC SILQAVVIDL DKDRISAESF WSFTMPWEVA        60
     ITTLRHRETI LLKVHLN                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page