(data stored in ACNUC8465 zone)

EMBL: CP000828.PE694

CP000828.PE694       Location/Qualifiers
FT   CDS             complement(719675..719980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0741"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25785"
FT                   /db_xref="UniProtKB/TrEMBL:B0CF98"
FT                   /protein_id="ABW25785.1"
FT                   /translation="MSIADGVSLFQVTVDAPSRVGIKTLSHGGGRLADGPGPDISPGGF
FT                   DPILTLFDSNNTFIAENDAREGRSDPTTGSAYDSRIVRSLTPGTYESCSEPIQQFL"
     MSIADGVSLF QVTVDAPSRV GIKTLSHGGG RLADGPGPDI SPGGFDPILT LFDSNNTFIA        60
     ENDAREGRSD PTTGSAYDSR IVRSLTPGTY ESCSEPIQQF L                           101
//

If you have problems or comments...

PBIL Back to PBIL home page