(data stored in ACNUC27125 zone)

EMBL: CP000828.PE698

CP000828.PE698       Location/Qualifiers
FT   CDS             723998..724600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0745"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25789"
FT                   /db_xref="UniProtKB/TrEMBL:B0CFA2"
FT                   /protein_id="ABW25789.1"
FT                   /translation="MKNLLTGAGVSLLVTTIASFGSVNVSLAQETSIDPQSLPGNYGLV
FT                   RSFDGQNLEVRLLDGTQKTYSVPEGTSASLEQGDLIGFDLDKEGTMVSNVQPPVVDEVI
FT                   RGTVTDVDLESETVTLLPEGADAPIDTRVSQSTISRLGLEPGKEMMVTKFADTWATKVC
FT                   LPRAAAPVVAPPVQEPIVPFGGAEPDPIPSEPIPALW"
     MKNLLTGAGV SLLVTTIASF GSVNVSLAQE TSIDPQSLPG NYGLVRSFDG QNLEVRLLDG        60
     TQKTYSVPEG TSASLEQGDL IGFDLDKEGT MVSNVQPPVV DEVIRGTVTD VDLESETVTL       120
     LPEGADAPID TRVSQSTISR LGLEPGKEMM VTKFADTWAT KVCLPRAAAP VVAPPVQEPI       180
     VPFGGAEPDP IPSEPIPALW                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page