(data stored in ACNUC27125 zone)

EMBL: CP000828.PE699

CP000828.PE699       Location/Qualifiers
FT   CDS             724701..724994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0746"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25790"
FT                   /db_xref="GOA:B0CFA3"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:B0CFA3"
FT                   /protein_id="ABW25790.1"
FT                   /translation="MKQLLIGMIQVYRRLISPLFPPSCRFHPTCSAYAIEAISTWGSVK
FT                   GSWLAAKRICRCNPFHPGGYDPVPTVATLSDSAHSETVDSEVDQDNSSHGSE"
     MKQLLIGMIQ VYRRLISPLF PPSCRFHPTC SAYAIEAIST WGSVKGSWLA AKRICRCNPF        60
     HPGGYDPVPT VATLSDSAHS ETVDSEVDQD NSSHGSE                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page