(data stored in ACNUC27125 zone)

EMBL: CP000828.PE7

CP000828.PE7         Location/Qualifiers
FT   CDS             complement(8126..8617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0009"
FT                   /product="CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25098"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:B0C4Y6"
FT                   /protein_id="ABW25098.1"
FT                   /translation="MAESHPVVKDFMTPDPITISPTDSIERVIKLIEDHRISGMPVVDA
FT                   SNHVVGIISEGDLLVRESPMQPPLYMTLLGSVIYFESPKQFHQHMQKALGMLVQDVMTS
FT                   QPITTKPDIPLTSAANLMLSKKINRLPVVDNDQYLIGIITRHDLVRALKPAVTYESLPD
FT                   "
     MAESHPVVKD FMTPDPITIS PTDSIERVIK LIEDHRISGM PVVDASNHVV GIISEGDLLV        60
     RESPMQPPLY MTLLGSVIYF ESPKQFHQHM QKALGMLVQD VMTSQPITTK PDIPLTSAAN       120
     LMLSKKINRL PVVDNDQYLI GIITRHDLVR ALKPAVTYES LPD                         163
//

If you have problems or comments...

PBIL Back to PBIL home page