(data stored in ACNUC27125 zone)

EMBL: CP000828.PE702

CP000828.PE702       Location/Qualifiers
FT   CDS             727214..728524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0749"
FT                   /product="band 7 protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25793"
FT                   /db_xref="GOA:B0CFA6"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:B0CFA6"
FT                   /protein_id="ABW25793.1"
FT                   /translation="MIAQVESSPRVNREEPGLPTAVPIAGAIFGVILVVWFLKNFLRIC
FT                   NPNEILILSGRKHRTKEGQTVGYRVIFGGRVISIPILESVKIMDMTTMPVPVEVKNAYS
FT                   KGGTPLDIQAIANVKISNDPAVVGNAIERFLDRDRKEILRVARETLEGNLRGVVALLTP
FT                   EQINEDRLEFAERIAQDVSRELAKLGLQLDTLKIQSVADEVDYLSSIGRRQIAQIVRDA
FT                   EIAESNAMGEAERIEADCQQQSEVAQTQALAVVQEKQNELRKIKAELEQRAKSEEERTI
FT                   AAGKEARARAEQQLQAMRADLERLRLEADEVLPAEAQRQAKALQARGEAASLGENAKAA
FT                   AQVNDMLSKVWEETGTDASEVFLIQQIEMVLQQAAEIPNRVKLDRINVIDNGDGQSIAS
FT                   LVNAYPEMVRQFLDRVDQTLGIDVTGTLKAQHQDKGE"
     MIAQVESSPR VNREEPGLPT AVPIAGAIFG VILVVWFLKN FLRICNPNEI LILSGRKHRT        60
     KEGQTVGYRV IFGGRVISIP ILESVKIMDM TTMPVPVEVK NAYSKGGTPL DIQAIANVKI       120
     SNDPAVVGNA IERFLDRDRK EILRVARETL EGNLRGVVAL LTPEQINEDR LEFAERIAQD       180
     VSRELAKLGL QLDTLKIQSV ADEVDYLSSI GRRQIAQIVR DAEIAESNAM GEAERIEADC       240
     QQQSEVAQTQ ALAVVQEKQN ELRKIKAELE QRAKSEEERT IAAGKEARAR AEQQLQAMRA       300
     DLERLRLEAD EVLPAEAQRQ AKALQARGEA ASLGENAKAA AQVNDMLSKV WEETGTDASE       360
     VFLIQQIEMV LQQAAEIPNR VKLDRINVID NGDGQSIASL VNAYPEMVRQ FLDRVDQTLG       420
     IDVTGTLKAQ HQDKGE                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page