(data stored in ACNUC8465 zone)

EMBL: CP000828.PE703

CP000828.PE703       Location/Qualifiers
FT   CDS             728527..730038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0750"
FT                   /product="SPFH domain / Band 7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25794"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:B0CFA7"
FT                   /protein_id="ABW25794.1"
FT                   /translation="MELVIVLLGVMGLGTGAVALVIRNLLYICQPSEVLIFAGSTQRSA
FT                   DGKRIGYRLVKGGKSVRKPLLERALRMDLTNMIIDLRVSNAYSKGGIPLQVEGVANIKI
FT                   AGEEPTIHNAIERLLGKSRKEIEQIAKETLEGNLRGVLASLTPEQVNEDKIAFAKSLLE
FT                   EAEDDLEQLGLVLDTLQIQNISDDVRYLDSIGRKQQADLQRDARISEAEAQAESTIKAA
FT                   ENERITSLKRLDRDIGIATAEAERRIQDAKTKRGAVVAEAEAEIASELARIQAEIPVQQ
FT                   ERIKQVEQQLQADVVAPAEAKCKRAIARAQGDAAQIIEDGKAQAEGTLRLAESWQKAGS
FT                   SARDIFLLQKLEVLLSTLTATVPDVTVQNVTVVDTTNGGGATKAAAFLEQIRHTTGMDI
FT                   AGAVQNIVKSDPAPKPIEPQMTEDDFVALRADVQNVLGIVAQSKLGGIQAERSVEAAVK
FT                   MNTSLQNRLQRALQAGGDAAIEALFEHPVIRIPSRIVEAWIQDDD"
     MELVIVLLGV MGLGTGAVAL VIRNLLYICQ PSEVLIFAGS TQRSADGKRI GYRLVKGGKS        60
     VRKPLLERAL RMDLTNMIID LRVSNAYSKG GIPLQVEGVA NIKIAGEEPT IHNAIERLLG       120
     KSRKEIEQIA KETLEGNLRG VLASLTPEQV NEDKIAFAKS LLEEAEDDLE QLGLVLDTLQ       180
     IQNISDDVRY LDSIGRKQQA DLQRDARISE AEAQAESTIK AAENERITSL KRLDRDIGIA       240
     TAEAERRIQD AKTKRGAVVA EAEAEIASEL ARIQAEIPVQ QERIKQVEQQ LQADVVAPAE       300
     AKCKRAIARA QGDAAQIIED GKAQAEGTLR LAESWQKAGS SARDIFLLQK LEVLLSTLTA       360
     TVPDVTVQNV TVVDTTNGGG ATKAAAFLEQ IRHTTGMDIA GAVQNIVKSD PAPKPIEPQM       420
     TEDDFVALRA DVQNVLGIVA QSKLGGIQAE RSVEAAVKMN TSLQNRLQRA LQAGGDAAIE       480
     ALFEHPVIRI PSRIVEAWIQ DDD                                               503
//

If you have problems or comments...

PBIL Back to PBIL home page