(data stored in ACNUC5340 zone)

EMBL: CP000828.PE71

CP000828.PE71        Location/Qualifiers
FT   CDS             complement(75663..80873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25162"
FT                   /db_xref="GOA:B0C550"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="InterPro:IPR008023"
FT                   /db_xref="UniProtKB/TrEMBL:B0C550"
FT                   /protein_id="ABW25162.1"
FT                   /translation="MPQEPSGGEQAPRPSRRLWLILFSRPVIGTALILLGILIWGGWRI
FT                   LGFINNELAPQIAKELTKSLNRPVLLGDVQSYSLTGLQFGPSSVPAHTYSSNGRTIEDK
FT                   DAGKVQTVNVQFDVWKALWTRTLNLDVTLVDAELYLDQTEDGEWISTTLTQEDSEGLVK
FT                   IQLDSLSVDGGEAVIDPYGAEARTLRNLKGVLTLHDNNEKLKVEGNGTLDSGGKARLKG
FT                   EWLQPSQSLKLDVKAKQVQITPLMGFVPTEIPIQIRSGEVDGDFQLTYQPQEPIQLTGT
FT                   TEVKDADIRVPEQNIWVKAEEFQGELDVEYSPNQQLPKVGGEAQFRSADLYVPENLLFQ
FT                   NGRSQRQQLRRTNGTLKFLKDEELLQFEARGTIASGGRLRTKGETTLDLSKIKVSVLAQ
FT                   NVSAPIFDRAFQTPVAIRSGQVDANVTLYLDQAKRPSMRGTARMKDIDAQLIGLPKSFY
FT                   DANGFIRLRGLTATLEGVTARYDQVPVAAKGSIDIDRGYSLSAQVPGLDVNTALTTMEV
FT                   PALPVPIAGEVSLPEIRITGPIDRPFIAGEVVMASGTKIDRVPFETIKAQFILDNPSLN
FT                   VSRILAVPEAGGEITGTARYNLLPGADLAADVDVVGLPGDAIASLYDVPSGLTIGPINA
FT                   QTQVRGQPEDLRTQIAFQAPRATYPTNGEMRLRKGITRLDNVVAQVAGGTARLDGYFDQ
FT                   TDLKADVRLAGIKLSNFAPELKGALSGNIALNGPIAALSPNTLRAQGQVNFSQGLSLLE
FT                   QPLDARFRWTGRQIVVQSATAKGFRADGTIDANLQSPQGPQITAMDLNIKADNYDLRTL
FT                   AALGPTAIPLTGQADLIGRITGTPEAPNLVATLQLEDLALFQFRFEPVMKGDLAFGPGV
FT                   EMKVGGERDRIDVSLNSQFLPNSFLIRRDQAIAQGTTQGNILRAEVKQFPLQPLNLGSI
FT                   ANLGLGTVSGTASGQFLANLKQQTLEGSFAVDQPALNQIQAKTLTGKIRYRDGIANLDQ
FT                   GTLLKDESQYVLNAKFIASDNPQYSGDLAITKGNIADVVALYESIDFANIGSPQQPKTY
FT                   GTAADLQTIPVGVNGPLLSQLRRFSEIRQLAILQANQQEQSLFALDGLTGQFGGQIDFA
FT                   GSVKTGVNADFDIRGQDFKLGLSGIDQLVVKGELEDGLLSLQPLRVKTGESLLAFQGQL
FT                   GSSYQSGRLRLQNISVEPINPFLDLPVTVTGKLNGTLNLAGNLEDPQLEGQFELVEGRL
FT                   DDAVINSAQTTLSYKQALLKIDSQARINNSQPLVLKGEVPFVPVFSTVKPATDQVSLTA
FT                   SIRNDGLSLLSLFTDQVTWEGGNGALDVNVKGTIDQPIVDGSIRFQDAKLQAAALKQPL
FT                   TNLNGLIKFDSNLVTIPRLTAKIDDGQLETTGSLPIFQGSNQQALAVKLEDLDLNVQEL
FT                   YQGGVNGAIVVKGSALQPRISGKLQLSNGKVKLANASGADSSAPGTVSQPGVDNPIKFN
FT                   NLVVQIGDNVKISQPPVLSFIANGDLTINGQVDQPLADGVVRFRKGSINLATTLFSVDP
FT                   RRENYASFDSQFGLDPYLNIGMKTTVTEVVRATTTDLNEFAEVPSSAIGAVQSVKVNAT
FT                   VDGRASELLANFDKVVTLSSRPSRTNPQIIALLGGGLERSLQDGQATQAAANIASSAAF
FT                   SSVQQALNDALGSRASFRAFPVLLPNQNNNQSAVLAFGAELGFDITDRFSASVLQILTG
FT                   VDEPTLFNLSYEINNQIRARSSISSEGEAVGVLEYRIQF"
     MPQEPSGGEQ APRPSRRLWL ILFSRPVIGT ALILLGILIW GGWRILGFIN NELAPQIAKE        60
     LTKSLNRPVL LGDVQSYSLT GLQFGPSSVP AHTYSSNGRT IEDKDAGKVQ TVNVQFDVWK       120
     ALWTRTLNLD VTLVDAELYL DQTEDGEWIS TTLTQEDSEG LVKIQLDSLS VDGGEAVIDP       180
     YGAEARTLRN LKGVLTLHDN NEKLKVEGNG TLDSGGKARL KGEWLQPSQS LKLDVKAKQV       240
     QITPLMGFVP TEIPIQIRSG EVDGDFQLTY QPQEPIQLTG TTEVKDADIR VPEQNIWVKA       300
     EEFQGELDVE YSPNQQLPKV GGEAQFRSAD LYVPENLLFQ NGRSQRQQLR RTNGTLKFLK       360
     DEELLQFEAR GTIASGGRLR TKGETTLDLS KIKVSVLAQN VSAPIFDRAF QTPVAIRSGQ       420
     VDANVTLYLD QAKRPSMRGT ARMKDIDAQL IGLPKSFYDA NGFIRLRGLT ATLEGVTARY       480
     DQVPVAAKGS IDIDRGYSLS AQVPGLDVNT ALTTMEVPAL PVPIAGEVSL PEIRITGPID       540
     RPFIAGEVVM ASGTKIDRVP FETIKAQFIL DNPSLNVSRI LAVPEAGGEI TGTARYNLLP       600
     GADLAADVDV VGLPGDAIAS LYDVPSGLTI GPINAQTQVR GQPEDLRTQI AFQAPRATYP       660
     TNGEMRLRKG ITRLDNVVAQ VAGGTARLDG YFDQTDLKAD VRLAGIKLSN FAPELKGALS       720
     GNIALNGPIA ALSPNTLRAQ GQVNFSQGLS LLEQPLDARF RWTGRQIVVQ SATAKGFRAD       780
     GTIDANLQSP QGPQITAMDL NIKADNYDLR TLAALGPTAI PLTGQADLIG RITGTPEAPN       840
     LVATLQLEDL ALFQFRFEPV MKGDLAFGPG VEMKVGGERD RIDVSLNSQF LPNSFLIRRD       900
     QAIAQGTTQG NILRAEVKQF PLQPLNLGSI ANLGLGTVSG TASGQFLANL KQQTLEGSFA       960
     VDQPALNQIQ AKTLTGKIRY RDGIANLDQG TLLKDESQYV LNAKFIASDN PQYSGDLAIT      1020
     KGNIADVVAL YESIDFANIG SPQQPKTYGT AADLQTIPVG VNGPLLSQLR RFSEIRQLAI      1080
     LQANQQEQSL FALDGLTGQF GGQIDFAGSV KTGVNADFDI RGQDFKLGLS GIDQLVVKGE      1140
     LEDGLLSLQP LRVKTGESLL AFQGQLGSSY QSGRLRLQNI SVEPINPFLD LPVTVTGKLN      1200
     GTLNLAGNLE DPQLEGQFEL VEGRLDDAVI NSAQTTLSYK QALLKIDSQA RINNSQPLVL      1260
     KGEVPFVPVF STVKPATDQV SLTASIRNDG LSLLSLFTDQ VTWEGGNGAL DVNVKGTIDQ      1320
     PIVDGSIRFQ DAKLQAAALK QPLTNLNGLI KFDSNLVTIP RLTAKIDDGQ LETTGSLPIF      1380
     QGSNQQALAV KLEDLDLNVQ ELYQGGVNGA IVVKGSALQP RISGKLQLSN GKVKLANASG      1440
     ADSSAPGTVS QPGVDNPIKF NNLVVQIGDN VKISQPPVLS FIANGDLTIN GQVDQPLADG      1500
     VVRFRKGSIN LATTLFSVDP RRENYASFDS QFGLDPYLNI GMKTTVTEVV RATTTDLNEF      1560
     AEVPSSAIGA VQSVKVNATV DGRASELLAN FDKVVTLSSR PSRTNPQIIA LLGGGLERSL      1620
     QDGQATQAAA NIASSAAFSS VQQALNDALG SRASFRAFPV LLPNQNNNQS AVLAFGAELG      1680
     FDITDRFSAS VLQILTGVDE PTLFNLSYEI NNQIRARSSI SSEGEAVGVL EYRIQF          1736
//

If you have problems or comments...

PBIL Back to PBIL home page