(data stored in ACNUC27125 zone)

EMBL: CP000828.PE710

CP000828.PE710       Location/Qualifiers
FT   CDS             737655..738116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0757"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0757"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25801"
FT                   /db_xref="GOA:B0CFB4"
FT                   /db_xref="UniProtKB/TrEMBL:B0CFB4"
FT                   /protein_id="ABW25801.1"
FT                   /translation="MSQFSDFSIYGIGVSVLGYRPFPNGLYRVTLWITIFFIPIFPLTS
FT                   RVVRPFKFQDSSVNRVFIGDSFGFDIIGQEPLHLPNVIRTYILGWSLALLALAPVVLCI
FT                   RHGQNYWPNGGSPEWFVFLTVTSIIWPILILGFLNHRKNQIHEGLIRKE"
     MSQFSDFSIY GIGVSVLGYR PFPNGLYRVT LWITIFFIPI FPLTSRVVRP FKFQDSSVNR        60
     VFIGDSFGFD IIGQEPLHLP NVIRTYILGW SLALLALAPV VLCIRHGQNY WPNGGSPEWF       120
     VFLTVTSIIW PILILGFLNH RKNQIHEGLI RKE                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page