(data stored in ACNUC27125 zone)

EMBL: CP000828.PE79

CP000828.PE79        Location/Qualifiers
FT   CDS             87745..88260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0082"
FT                   /product="TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25170"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B0C558"
FT                   /protein_id="ABW25170.1"
FT                   /translation="MLITSHRSWLFPTLLITVLLSVGSGQGSYAKPHTHPSPLENIALS
FT                   REDQSQILFSTGIQKALNGDYVHAIQDYDQALQLAPSNSEVYYNRGVAYFSINRPQSAL
FT                   RDFSQAIALQPNMAEAYGNRGLIRQTLGDRKGAIADYQQAKQLFQKSGNQPAAEQMEHW
FT                   IDQQGTPQ"
     MLITSHRSWL FPTLLITVLL SVGSGQGSYA KPHTHPSPLE NIALSREDQS QILFSTGIQK        60
     ALNGDYVHAI QDYDQALQLA PSNSEVYYNR GVAYFSINRP QSALRDFSQA IALQPNMAEA       120
     YGNRGLIRQT LGDRKGAIAD YQQAKQLFQK SGNQPAAEQM EHWIDQQGTP Q                171
//

If you have problems or comments...

PBIL Back to PBIL home page