(data stored in ACNUC27125 zone)

EMBL: CP000828.PE80

CP000828.PE80        Location/Qualifiers
FT   CDS             88341..89213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0083"
FT                   /product="rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25171"
FT                   /db_xref="GOA:B0C559"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:B0C559"
FT                   /protein_id="ABW25171.1"
FT                   /translation="MAFNLPKRQTSGSVVCFSCQKLVSIEQEECPQCGQVNPGLWGYAR
FT                   PIRRVGADFGFIKIVIIGCIALYLITLLFDLPGIRSEGVMNLLMPSSYSLLIFGSTGSV
FT                   PIFEWGRWWTVLSSGWLHGGLWHLGFNMAWLNYLSPMVAKGYGAGRLVSIYTFTTLTSS
FT                   LLTSFVAQYWTSLPPSFRGSNFSVGASGGVFGLLGALVIYGQRAHKRQVLQQALTLTII
FT                   SFVLSAFVGRVDNWGHLGGFIGGYLIGLTSWFNPNQPQSLYHLGIAIGALVVTFVSIIL
FT                   SPVHALLIG"
     MAFNLPKRQT SGSVVCFSCQ KLVSIEQEEC PQCGQVNPGL WGYARPIRRV GADFGFIKIV        60
     IIGCIALYLI TLLFDLPGIR SEGVMNLLMP SSYSLLIFGS TGSVPIFEWG RWWTVLSSGW       120
     LHGGLWHLGF NMAWLNYLSP MVAKGYGAGR LVSIYTFTTL TSSLLTSFVA QYWTSLPPSF       180
     RGSNFSVGAS GGVFGLLGAL VIYGQRAHKR QVLQQALTLT IISFVLSAFV GRVDNWGHLG       240
     GFIGGYLIGL TSWFNPNQPQ SLYHLGIAIG ALVVTFVSII LSPVHALLIG                  290
//

If you have problems or comments...

PBIL Back to PBIL home page