(data stored in ACNUC27125 zone)

EMBL: CP000828.PE81

CP000828.PE81        Location/Qualifiers
FT   CDS             89647..91185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0084"
FT                   /product="phosphoglucomutase/phosphomannomutase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25172"
FT                   /db_xref="GOA:B0C560"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="UniProtKB/TrEMBL:B0C560"
FT                   /protein_id="ABW25172.1"
FT                   /translation="MTLTAFNWPQLQNGSDIRGVALEGVEGEAVNLTPEIAQILGMAFV
FT                   HWLSQTLNKSTSELTVGVGRDSRISGPTLMDAVLAGITKMGSNGYNFGLASTPAMFKST
FT                   VTDGFNCDGAIMLTASHLPFNRNGLKFFTAQGGLGKGDITQILSLAAEQTFEKAADPGQ
FT                   VSEHNFIGVYAAELVSQIRAAVNHPDQFEQPLQGLHIVVDAGNGAGGFYAEQVLKPLGA
FT                   DITGSQFLDPDGTFPNHIPNPENKEAMAAICQAVTEQQADFGIIFDTDVDRAAAVDHLG
FT                   QDLNRNRLIALISAVVLREHPGSTIVTDSITSDGLSQFIGDELGGVHHRFKRGYKNVIN
FT                   ESVRLNQSGQESWLAIETSGHGAMKENYFLDDGAYLISKLLVELAKSKMAGRNITDLIA
FT                   NLTEPQESEEYRIKIQTDDFKAHGNSVISKLEEFAGQQTDWQIVPNNYEGIRIALNSPS
FT                   EQGWLLLRLSLHDPVLPLNIESNVEGGVASISAKLTSFFQSIDGLNLPPELISS"
     MTLTAFNWPQ LQNGSDIRGV ALEGVEGEAV NLTPEIAQIL GMAFVHWLSQ TLNKSTSELT        60
     VGVGRDSRIS GPTLMDAVLA GITKMGSNGY NFGLASTPAM FKSTVTDGFN CDGAIMLTAS       120
     HLPFNRNGLK FFTAQGGLGK GDITQILSLA AEQTFEKAAD PGQVSEHNFI GVYAAELVSQ       180
     IRAAVNHPDQ FEQPLQGLHI VVDAGNGAGG FYAEQVLKPL GADITGSQFL DPDGTFPNHI       240
     PNPENKEAMA AICQAVTEQQ ADFGIIFDTD VDRAAAVDHL GQDLNRNRLI ALISAVVLRE       300
     HPGSTIVTDS ITSDGLSQFI GDELGGVHHR FKRGYKNVIN ESVRLNQSGQ ESWLAIETSG       360
     HGAMKENYFL DDGAYLISKL LVELAKSKMA GRNITDLIAN LTEPQESEEY RIKIQTDDFK       420
     AHGNSVISKL EEFAGQQTDW QIVPNNYEGI RIALNSPSEQ GWLLLRLSLH DPVLPLNIES       480
     NVEGGVASIS AKLTSFFQSI DGLNLPPELI SS                                     512
//

If you have problems or comments...

PBIL Back to PBIL home page