(data stored in ACNUC8465 zone)

EMBL: CP000828.PE87

CP000828.PE87        Location/Qualifiers
FT   CDS             complement(95663..97660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0090"
FT                   /product="glycogen debranching enzyme, archaeal type,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25178"
FT                   /db_xref="GOA:B0C684"
FT                   /db_xref="InterPro:IPR006451"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010401"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR024742"
FT                   /db_xref="InterPro:IPR032790"
FT                   /db_xref="UniProtKB/TrEMBL:B0C684"
FT                   /protein_id="ABW25178.1"
FT                   /translation="MIQLGREITSELQIASTREWLVTNGIGGYAAGTVAGLLTRRYHGL
FT                   LIAALNPPLERTLLLSKLEETALYNGELFELSTNQWADGSVTPQGYRYLEKFELEGTVP
FT                   CWSYALADALLEKRVWMQQGENTTYIYYQLQRGSGPVALSVKALINYRDHHSQTHSHQW
FT                   QMQTQSVAQGIRIKANDTATPFYLLVSQGGLVTQHQWYQGFELGLEQYRGLDDQDNHLH
FT                   ITTLEVVLNPGDSLTVVASTLPQANLDGATALLERRFYEEMIRGELDVPASPMPQWIQQ
FT                   LALAADQFIVNRPLAEEPEGKTIIAGYPWFGDWGRDTMISLPGLTISTGRPRIARTIIR
FT                   TFARYLNQGMLPNVFPEVGKLPDYNTVDAILWYFEAIRIYTVAIQDNELLEELFPVLVR
FT                   VIDWHRQGTRYQIHVDTDGLLYAGEEGAQLTWMDAKIGDWVVTPRMGKPIEINALWYNA
FT                   LRSMERFAQQLGQPQQVYRDMAQLMVEGFQRFWQPSQGYCADVIDGPQGDDLTLRPNQI
FT                   FAVSLPLVSGAADHPALLTDEQQQAVVETCGRYLLTSYGLRSLSPDDPQYQGTYGGDQV
FT                   KRDSRYHQGTVWGWLLGPYVQAHYRVYKNPQQALSLLNPIANHLQTHGLGSISEIFDGD
FT                   PPFYPRGCFTQAWSVAEILRAWMDISQQQY"
     MIQLGREITS ELQIASTREW LVTNGIGGYA AGTVAGLLTR RYHGLLIAAL NPPLERTLLL        60
     SKLEETALYN GELFELSTNQ WADGSVTPQG YRYLEKFELE GTVPCWSYAL ADALLEKRVW       120
     MQQGENTTYI YYQLQRGSGP VALSVKALIN YRDHHSQTHS HQWQMQTQSV AQGIRIKAND       180
     TATPFYLLVS QGGLVTQHQW YQGFELGLEQ YRGLDDQDNH LHITTLEVVL NPGDSLTVVA       240
     STLPQANLDG ATALLERRFY EEMIRGELDV PASPMPQWIQ QLALAADQFI VNRPLAEEPE       300
     GKTIIAGYPW FGDWGRDTMI SLPGLTISTG RPRIARTIIR TFARYLNQGM LPNVFPEVGK       360
     LPDYNTVDAI LWYFEAIRIY TVAIQDNELL EELFPVLVRV IDWHRQGTRY QIHVDTDGLL       420
     YAGEEGAQLT WMDAKIGDWV VTPRMGKPIE INALWYNALR SMERFAQQLG QPQQVYRDMA       480
     QLMVEGFQRF WQPSQGYCAD VIDGPQGDDL TLRPNQIFAV SLPLVSGAAD HPALLTDEQQ       540
     QAVVETCGRY LLTSYGLRSL SPDDPQYQGT YGGDQVKRDS RYHQGTVWGW LLGPYVQAHY       600
     RVYKNPQQAL SLLNPIANHL QTHGLGSISE IFDGDPPFYP RGCFTQAWSV AEILRAWMDI       660
     SQQQY                                                                   665
//

If you have problems or comments...

PBIL Back to PBIL home page