(data stored in ACNUC27125 zone)

EMBL: CP000828.PE89

CP000828.PE89        Location/Qualifiers
FT   CDS             complement(98427..98576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25180"
FT                   /db_xref="UniProtKB/TrEMBL:B0C686"
FT                   /protein_id="ABW25180.1"
FT                   /translation="MIDLESKKLALPSTYYAPLQQVFSSSHQFDLSSLDAIGNTCDRNT
FT                   DLEL"
     MIDLESKKLA LPSTYYAPLQ QVFSSSHQFD LSSLDAIGNT CDRNTDLEL                    49
//

If you have problems or comments...

PBIL Back to PBIL home page