(data stored in ACNUC8465 zone)

EMBL: CP000828.PE95

CP000828.PE95        Location/Qualifiers
FT   CDS             101177..101296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25186"
FT                   /db_xref="UniProtKB/TrEMBL:B0C692"
FT                   /protein_id="ABW25186.1"
FT                   /translation="MFEHELDLAYAVMDGVKARAQAGNYEVERFRFPSRLAAS"
     MFEHELDLAY AVMDGVKARA QAGNYEVERF RFPSRLAAS                               39
//

If you have problems or comments...

PBIL Back to PBIL home page