(data stored in ACNUC8465 zone)

EMBL: CP000828.PE96

CP000828.PE96        Location/Qualifiers
FT   CDS             complement(101485..102453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25187"
FT                   /db_xref="GOA:B0C693"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B0C693"
FT                   /protein_id="ABW25187.1"
FT                   /translation="MEKSGHYTHGVDWFFNGKTQRAERGIEWSVIAIIDLAQHTGYTLS
FT                   AQQTEAGLQAKPPEPSRLAKDSPSPTSRVDFYVGHLVECDSYLPERVCYIVADGFYSKR
FT                   KWINAVVQINRHAIGKLRCDANLKFLYRGPQKRQGRRRRYAAKVELADPSNLTFVCELE
FT                   SGDQLYMAVVWSVSLKRAIRMAYVCGHKDGKHSYAVLFSTDLDIDPYDIYRYYSARFQI
FT                   EFIFRDARLFTGLTHCQVRNANALDSHVNASLLALNLAKAAWRRDCQKAEPSRFSIASF
FT                   KRWALNEHLLELFIDMFELDPTLIKSHINYQKLLKYGAIDH"
     MEKSGHYTHG VDWFFNGKTQ RAERGIEWSV IAIIDLAQHT GYTLSAQQTE AGLQAKPPEP        60
     SRLAKDSPSP TSRVDFYVGH LVECDSYLPE RVCYIVADGF YSKRKWINAV VQINRHAIGK       120
     LRCDANLKFL YRGPQKRQGR RRRYAAKVEL ADPSNLTFVC ELESGDQLYM AVVWSVSLKR       180
     AIRMAYVCGH KDGKHSYAVL FSTDLDIDPY DIYRYYSARF QIEFIFRDAR LFTGLTHCQV       240
     RNANALDSHV NASLLALNLA KAAWRRDCQK AEPSRFSIAS FKRWALNEHL LELFIDMFEL       300
     DPTLIKSHIN YQKLLKYGAI DH                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page