(data stored in ACNUC5340 zone)

EMBL: CP000828.PHET

CP000828.PHET        Location/Qualifiers
FT   CDS             294350..295651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="AM1_0314"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25380"
FT                   /db_xref="GOA:B0C9U0"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR021122"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9U0"
FT                   /protein_id="ABW25380.1"
FT                   /translation="MTVIVMEVIKVARHPNADSLNVYEMQVPGHPSVQVIGNLERIYGV
FT                   GEHVLVAQVNSVLKDGTKIKATKLRGIISYGMALEKTELPVGEDVSQTYCQQSVVQSVQ
FT                   MQRWPSVELLHNVRRSLMALEATPMVTYRAKIKLDGTNAGVQIFSDGRVAAQSRSQIIT
FT                   PDDDNMGFAQWVSQQMDYFAPLAGHEHITIFGEWCGRGIQKRTSISKIDRRIFTVFAVQ
FT                   YGGVENEVAKLEIDPDKISQLLPSHPDIFVLPFMGEPLTLDFGNRDQLESVANAINQLV
FT                   SEVEQIDPWVKATFGIEGLGEGLVLYPQTQTRVDRLTYPELMFKAKGEKHQVVKTKQPV
FT                   QLDPEFVKSIDEFVALMVTPARLEQGLSESCQGPLEMKQLGGFLKWLAQDVQKESEAEL
FT                   EAAKLSWKDVNKAVTHSGKSWFRDRILSLTDIAQ"
     MTVIVMEVIK VARHPNADSL NVYEMQVPGH PSVQVIGNLE RIYGVGEHVL VAQVNSVLKD        60
     GTKIKATKLR GIISYGMALE KTELPVGEDV SQTYCQQSVV QSVQMQRWPS VELLHNVRRS       120
     LMALEATPMV TYRAKIKLDG TNAGVQIFSD GRVAAQSRSQ IITPDDDNMG FAQWVSQQMD       180
     YFAPLAGHEH ITIFGEWCGR GIQKRTSISK IDRRIFTVFA VQYGGVENEV AKLEIDPDKI       240
     SQLLPSHPDI FVLPFMGEPL TLDFGNRDQL ESVANAINQL VSEVEQIDPW VKATFGIEGL       300
     GEGLVLYPQT QTRVDRLTYP ELMFKAKGEK HQVVKTKQPV QLDPEFVKSI DEFVALMVTP       360
     ARLEQGLSES CQGPLEMKQL GGFLKWLAQD VQKESEAELE AAKLSWKDVN KAVTHSGKSW       420
     FRDRILSLTD IAQ                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page