(data stored in ACNUC27125 zone)

EMBL: CP000828.PILB

CP000828.PILB        Location/Qualifiers
FT   CDS             complement(392968..394974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilB"
FT                   /locus_tag="AM1_0419"
FT                   /product="type IV pilus assembly protein PilB"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25476"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:B0CAY6"
FT                   /protein_id="ABW25476.1"
FT                   /translation="MVNSSSQRRALVTRHNFSPFGNKLISTGYVDQDQMREATLESRRS
FT                   GRSLVEILQGLTGQSLPPELLRQYKRQQLFELKILYGIDSLDLELSQIPTDQIEELIQN
FT                   YISLDLCRRYQLVPLTLDKETDPATLLVAMVDPDNLGALDDLGRILREKNLTLQRMVIA
FT                   VEDYQQLISKYLDQQAAEQKANEKPIEFDLDDDLDAIAGLDDLPSDELETDLGAALQDA
FT                   ETAPIIGLVNKILAKALQNGVSDIHIEPQEDHLRVRFRKDGVLQQAFDPLPRKIIPAVI
FT                   SRFKIISDLDIAERRLPQDGRIRRLFQGRKIDFRVNTLPSRYGEKIVLRILDNSSTQLG
FT                   LDKLVSDEDSLNIVREMVSRPFGLILVTGPTGSGKTTTLYSALAECNHPGVNISTAEDP
FT                   IEYTLPGLTQVQVIREKGMDFASILRAFLRQDPDVILVGETRDKETAKTAIEAALTGHL
FT                   VLTTLHTNDAASAVARLAEMEVEPFMVSASLLGVVAQRLVRRVCSDCKVPYQPTPTELG
FT                   RFGLSASPGTEITFYKANTLSADELQTAQATGQTVCSTCNGIGYKGRCGVYEVMQITET
FT                   LQTLITEGAPTERIKEVAVEEGMKTLLAYSLELVKKGDTTLAEVERVTFTDSGLEAELK
FT                   AKRKTSLTCRVCDADLRPEWLDCPYCTTPRFQD"
     MVNSSSQRRA LVTRHNFSPF GNKLISTGYV DQDQMREATL ESRRSGRSLV EILQGLTGQS        60
     LPPELLRQYK RQQLFELKIL YGIDSLDLEL SQIPTDQIEE LIQNYISLDL CRRYQLVPLT       120
     LDKETDPATL LVAMVDPDNL GALDDLGRIL REKNLTLQRM VIAVEDYQQL ISKYLDQQAA       180
     EQKANEKPIE FDLDDDLDAI AGLDDLPSDE LETDLGAALQ DAETAPIIGL VNKILAKALQ       240
     NGVSDIHIEP QEDHLRVRFR KDGVLQQAFD PLPRKIIPAV ISRFKIISDL DIAERRLPQD       300
     GRIRRLFQGR KIDFRVNTLP SRYGEKIVLR ILDNSSTQLG LDKLVSDEDS LNIVREMVSR       360
     PFGLILVTGP TGSGKTTTLY SALAECNHPG VNISTAEDPI EYTLPGLTQV QVIREKGMDF       420
     ASILRAFLRQ DPDVILVGET RDKETAKTAI EAALTGHLVL TTLHTNDAAS AVARLAEMEV       480
     EPFMVSASLL GVVAQRLVRR VCSDCKVPYQ PTPTELGRFG LSASPGTEIT FYKANTLSAD       540
     ELQTAQATGQ TVCSTCNGIG YKGRCGVYEV MQITETLQTL ITEGAPTERI KEVAVEEGMK       600
     TLLAYSLELV KKGDTTLAEV ERVTFTDSGL EAELKAKRKT SLTCRVCDAD LRPEWLDCPY       660
     CTTPRFQD                                                                668
//

If you have problems or comments...

PBIL Back to PBIL home page