(data stored in ACNUC27125 zone)

EMBL: CP000828.PILC

CP000828.PILC        Location/Qualifiers
FT   CDS             complement(390490..391710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilC"
FT                   /locus_tag="AM1_0417"
FT                   /product="type II secretion system domain protein/ pilin
FT                   biogenesis protein PilC"
FT                   /note="Member of bacterial type II secretion system protein
FT                   F domain, PF00482."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25474"
FT                   /db_xref="GOA:B0CAY4"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:B0CAY4"
FT                   /protein_id="ABW25474.1"
FT                   /translation="MPTYVVRARDSQGKSSQKRVNATSQKEARSNIQRQGLQILDIKES
FT                   QGFSMNAELDLSFLQSITVKDKALFSRQFSALVNAGVALVRGLGVMSEQCKNPKLKKAL
FT                   LDVNAAVQQGVSLSDAMRGHPAAFDQLYVAMIQAGETGGVLDEVLNRLATLLEDQARLK
FT                   NQIRSALAYPVVVGFIAVSIFLGMVIFLIPVFDGIFSQLGGDLPAFTQFMVNLSEFLRT
FT                   PIYGISAAIVVFGSTFALRQYYRTRAGRETIDRIMLKLPLFGDLIQKTAVARFCRTFGS
FT                   LSRSGVPILYSLEIVRDTAGNQVVSNAIDEARREIQGGGMLSLALQKEKVFPLLATQMI
FT                   NVGEETGEIDKMLMKVADFYEDEVEQAVKAMTSVMEPLMIVVLGGMVGSILVAMYLPMF
FT                   KIFDLIG"
     MPTYVVRARD SQGKSSQKRV NATSQKEARS NIQRQGLQIL DIKESQGFSM NAELDLSFLQ        60
     SITVKDKALF SRQFSALVNA GVALVRGLGV MSEQCKNPKL KKALLDVNAA VQQGVSLSDA       120
     MRGHPAAFDQ LYVAMIQAGE TGGVLDEVLN RLATLLEDQA RLKNQIRSAL AYPVVVGFIA       180
     VSIFLGMVIF LIPVFDGIFS QLGGDLPAFT QFMVNLSEFL RTPIYGISAA IVVFGSTFAL       240
     RQYYRTRAGR ETIDRIMLKL PLFGDLIQKT AVARFCRTFG SLSRSGVPIL YSLEIVRDTA       300
     GNQVVSNAID EARREIQGGG MLSLALQKEK VFPLLATQMI NVGEETGEID KMLMKVADFY       360
     EDEVEQAVKA MTSVMEPLMI VVLGGMVGSI LVAMYLPMFK IFDLIG                      406
//

If you have problems or comments...

PBIL Back to PBIL home page