(data stored in ACNUC5340 zone)

EMBL: CP000828.PILT

CP000828.PILT        Location/Qualifiers
FT   CDS             complement(391768..392889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="AM1_0418"
FT                   /product="type IV pili twitching motility protein PilT"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25475"
FT                   /db_xref="GOA:B0CAY5"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0CAY5"
FT                   /protein_id="ABW25475.1"
FT                   /translation="MDYMIEDLMEEVVERGGSDLHLSVGLPPYIRINGKLTPTDYDPLS
FT                   QEQCQRLIFSMLNNTQRKQLEQTWELDCSYGVRGLARFRVNVYKDRGTYAAALRALSSK
FT                   IPSIETLGLPNIVREMSEKPRGLVLVTGPTGSGKTTTLASMINNINLTRAEHILTVEDP
FT                   IEFVYEPIKSLIHQRQVGEDTKSFANALRAALREDPDVILVGEMRDLETIQLAISAAET
FT                   GHLVFGTLHTSSAAQTVDRMVDVFPPEQQTQVRVQLSNSLVAVFSQTLVTRKNPKPGEF
FT                   GRVMAQEIMVSTPGIANLIREGKTSQIYSAIQTGGKLGMVTLEKVLAELYRAGTISFES
FT                   AVSKTSRPDEMQRLMGAAPMGNQRGSGAAPYRR"
     MDYMIEDLME EVVERGGSDL HLSVGLPPYI RINGKLTPTD YDPLSQEQCQ RLIFSMLNNT        60
     QRKQLEQTWE LDCSYGVRGL ARFRVNVYKD RGTYAAALRA LSSKIPSIET LGLPNIVREM       120
     SEKPRGLVLV TGPTGSGKTT TLASMINNIN LTRAEHILTV EDPIEFVYEP IKSLIHQRQV       180
     GEDTKSFANA LRAALREDPD VILVGEMRDL ETIQLAISAA ETGHLVFGTL HTSSAAQTVD       240
     RMVDVFPPEQ QTQVRVQLSN SLVAVFSQTL VTRKNPKPGE FGRVMAQEIM VSTPGIANLI       300
     REGKTSQIYS AIQTGGKLGM VTLEKVLAEL YRAGTISFES AVSKTSRPDE MQRLMGAAPM       360
     GNQRGSGAAP YRR                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page