(data stored in ACNUC27125 zone)

EMBL: CP000828.PLSX

CP000828.PLSX        Location/Qualifiers
FT   CDS             639059..640093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="AM1_0652"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25700"
FT                   /db_xref="GOA:B0CE66"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0CE66"
FT                   /protein_id="ABW25700.1"
FT                   /translation="MGATRARIAIDAMGGDHAPDEIVAGALRAQAELDADVLLVGDPDR
FT                   LEASIKSHSDSVPVEIIPSEGLIEMNEEPISALRRKRKASINVAMDLVKKKKADAVVSA
FT                   GHSGAAMAAALLRLGRIPGIDRPAIGGVFPTIIAGKPVLVLDVGANVDCRPAFLDQFAT
FT                   MGTIYSEYVLGTEAPKVGLLNIGEESCKGNEVSVQTYQLLEQNPHVDFIGNAEGRDVLS
FT                   GQFDVIVCDGFTGNILLKFAEAVGEVALQILREELPRGIHGKVGTGILKPNLRRIKQRM
FT                   DHAEHGGGLLLGVAGVCIISHGSSQAPSIFNAIRLAKEAADNQVSQRIQSCYQQTVTAA
FT                   SNGE"
     MGATRARIAI DAMGGDHAPD EIVAGALRAQ AELDADVLLV GDPDRLEASI KSHSDSVPVE        60
     IIPSEGLIEM NEEPISALRR KRKASINVAM DLVKKKKADA VVSAGHSGAA MAAALLRLGR       120
     IPGIDRPAIG GVFPTIIAGK PVLVLDVGAN VDCRPAFLDQ FATMGTIYSE YVLGTEAPKV       180
     GLLNIGEESC KGNEVSVQTY QLLEQNPHVD FIGNAEGRDV LSGQFDVIVC DGFTGNILLK       240
     FAEAVGEVAL QILREELPRG IHGKVGTGIL KPNLRRIKQR MDHAEHGGGL LLGVAGVCII       300
     SHGSSQAPSI FNAIRLAKEA ADNQVSQRIQ SCYQQTVTAA SNGE                        344
//

If you have problems or comments...

PBIL Back to PBIL home page