(data stored in ACNUC5340 zone)

EMBL: CP000828.PPK2

CP000828.PPK2        Location/Qualifiers
FT   CDS             complement(306802..307761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk2"
FT                   /locus_tag="AM1_0335"
FT                   /product="polyphosphate kinase 2"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25394"
FT                   /db_xref="GOA:B0C9V4"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9V4"
FT                   /protein_id="ABW25394.1"
FT                   /translation="MSSKKKQNASPNSPPEKAEVQQDKPPKIKKKNKLSKKQKASRQLS
FT                   SERKIFHHISESEGSSKLSKKKYEKELARLQLELVKMQYWVKNTGTRIVIVFEGRDAAG
FT                   KGGTIKRITEPLNPRGCRVVALGTPSDREKTEWYFQRYVAHLPAAGEIVCFDRSWYNRA
FT                   GVEHVMGFCTDDQYEEFLQTCPEFEQMLVRSGIILLKYWFSVSDEEQERRFQTRTTDPA
FT                   RRWKLSPMDLESRDRWAEYSQAKDNMFAHTNIPEAPWFTVEADDKKRARLNCISHFLSK
FT                   IPYEDMTPEPMELPPRKKAPTDYVRPPLNEQFFVPQLY"
     MSSKKKQNAS PNSPPEKAEV QQDKPPKIKK KNKLSKKQKA SRQLSSERKI FHHISESEGS        60
     SKLSKKKYEK ELARLQLELV KMQYWVKNTG TRIVIVFEGR DAAGKGGTIK RITEPLNPRG       120
     CRVVALGTPS DREKTEWYFQ RYVAHLPAAG EIVCFDRSWY NRAGVEHVMG FCTDDQYEEF       180
     LQTCPEFEQM LVRSGIILLK YWFSVSDEEQ ERRFQTRTTD PARRWKLSPM DLESRDRWAE       240
     YSQAKDNMFA HTNIPEAPWF TVEADDKKRA RLNCISHFLS KIPYEDMTPE PMELPPRKKA       300
     PTDYVRPPLN EQFFVPQLY                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page