(data stored in ACNUC27125 zone)

EMBL: CP000828.PSBO

CP000828.PSBO        Location/Qualifiers
FT   CDS             complement(502849..503652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psbO"
FT                   /locus_tag="AM1_0526"
FT                   /product="photosystem II manganese-stabilizing protein
FT                   PsbO"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25578"
FT                   /db_xref="GOA:B0CC36"
FT                   /db_xref="InterPro:IPR002628"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC36"
FT                   /protein_id="ABW25578.1"
FT                   /translation="MRFRTLIVTFLAVCLGVFSVNAKALAVVPSSMTYDQVKGTGLADS
FT                   CPTLPTGTGDTISVGGSAYITDLCFQPTSFFVKEEPKNPRQEAEFVPASVMTRKTTTLE
FT                   QIEGPLSADGGGLTFKEKDGMDFQAITVQISGRERVPMLFTVKELLASASGSSIADGTS
FT                   FSGEYAVPSYRTSGFLDPKGRGVSTGYDNAVALPASADADKLNRANAKRFDLTKGSISM
FT                   DVASVDSETGEFGGTFESEQFSDSDLGAIDPLEVKVRGIFYGRVN"
     MRFRTLIVTF LAVCLGVFSV NAKALAVVPS SMTYDQVKGT GLADSCPTLP TGTGDTISVG        60
     GSAYITDLCF QPTSFFVKEE PKNPRQEAEF VPASVMTRKT TTLEQIEGPL SADGGGLTFK       120
     EKDGMDFQAI TVQISGRERV PMLFTVKELL ASASGSSIAD GTSFSGEYAV PSYRTSGFLD       180
     PKGRGVSTGY DNAVALPASA DADKLNRANA KRFDLTKGSI SMDVASVDSE TGEFGGTFES       240
     EQFSDSDLGA IDPLEVKVRG IFYGRVN                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page