(data stored in ACNUC27125 zone)

EMBL: CP000828.PSTA

CP000828.PSTA        Location/Qualifiers
FT   CDS             complement(179281..180216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="AM1_0175"
FT                   /product="phosphate ABC transporter, permease protein PstA"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25261"
FT                   /db_xref="GOA:B0C7K1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7K1"
FT                   /protein_id="ABW25261.1"
FT                   /translation="MTLSNPKDLPGLEDSENSQFKPALDTRYRWDRFFEALTWLATIIS
FT                   LVVLATLLFDVLSDGASSLSVDFLTSPPSRKAAKAGLWPALMGTVWLLCITAAVAFPIG
FT                   VGSGIFLEEFAPDNLFTRIIEINVGNLAAVPSIVYGLLGLTVFVDIMRPITGGSSVLAG
FT                   GLTLALLILPIIIVSTREALRAVPSSLRQGGFALGATRWQVIRDLVFPQSLPGILTGTI
FT                   LALSRAIGETAPILVVGAAGYIAFAPPLSLEGLQSDFTALPIQIYVWIARAQKSFEPIA
FT                   AGGIIILLVVLLLMNTTAILLRNKFQNQKL"
     MTLSNPKDLP GLEDSENSQF KPALDTRYRW DRFFEALTWL ATIISLVVLA TLLFDVLSDG        60
     ASSLSVDFLT SPPSRKAAKA GLWPALMGTV WLLCITAAVA FPIGVGSGIF LEEFAPDNLF       120
     TRIIEINVGN LAAVPSIVYG LLGLTVFVDI MRPITGGSSV LAGGLTLALL ILPIIIVSTR       180
     EALRAVPSSL RQGGFALGAT RWQVIRDLVF PQSLPGILTG TILALSRAIG ETAPILVVGA       240
     AGYIAFAPPL SLEGLQSDFT ALPIQIYVWI ARAQKSFEPI AAGGIIILLV VLLLMNTTAI       300
     LLRNKFQNQK L                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page