(data stored in ACNUC5340 zone)

EMBL: CP000828.PSTC

CP000828.PSTC        Location/Qualifiers
FT   CDS             complement(180213..181088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="AM1_0176"
FT                   /product="phosphate ABC transporter, permease protein PstC"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25262"
FT                   /db_xref="GOA:B0C7K2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7K2"
FT                   /protein_id="ABW25262.1"
FT                   /translation="MSVWSERIVKYLFASFALISIATTVGIVGTLIFETFEFFKEIPLI
FT                   RFLTDTQWTPLFSDQFGIFVLISATFMTSLIALMVALPIGLLAAICLSEYASPNVRRWL
FT                   KPALEVLAGIPTVVYGYFALLFVTPLLQGFVPGLKIFNSLSAGMVMGFAIMPLVASLSE
FT                   DAIYAVPQSLRQGSYALGTTKRETVTGVVLPAALSGIVASCVLAISRAVGETMIVTVAA
FT                   GASPVLTLDPRVSVQTMTSFIVQATFGDNPVGTIGYKTLFVVGMTLFLITFCLNVFSFW
FT                   FVRRFQEKYE"
     MSVWSERIVK YLFASFALIS IATTVGIVGT LIFETFEFFK EIPLIRFLTD TQWTPLFSDQ        60
     FGIFVLISAT FMTSLIALMV ALPIGLLAAI CLSEYASPNV RRWLKPALEV LAGIPTVVYG       120
     YFALLFVTPL LQGFVPGLKI FNSLSAGMVM GFAIMPLVAS LSEDAIYAVP QSLRQGSYAL       180
     GTTKRETVTG VVLPAALSGI VASCVLAISR AVGETMIVTV AAGASPVLTL DPRVSVQTMT       240
     SFIVQATFGD NPVGTIGYKT LFVVGMTLFL ITFCLNVFSF WFVRRFQEKY E                291
//

If you have problems or comments...

PBIL Back to PBIL home page