(data stored in ACNUC5340 zone)

EMBL: CP000828.RIBAB

CP000828.RIBAB       Location/Qualifiers
FT   CDS             complement(598330..600012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribAB"
FT                   /locus_tag="AM1_0608"
FT                   /product="riboflavin biosynthesis protein ribAB
FT                   (3,4-dihydroxy-2-butanone 4-phosphate synthase and GTP
FT                   cyclohydrolase II)"
FT                   /note="Gene codes for two domains the
FT                   3,4-dihydroxy-2-butanone 4-phosphate synthase which is ribA
FT                   and the GTP cyclohydrolase II which is ribB."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25658"
FT                   /db_xref="GOA:B0CD67"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR016299"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:B0CD67"
FT                   /protein_id="ABW25658.1"
FT                   /translation="MNPHATPTDSFEFDSIEDALAEFKAGHAIVVVDDENRENEGDLIC
FT                   AAQFATPDMINFMAVEARGLICLAMTGERLDALELPLMVTNNTDMNQTAFTVSIDASPH
FT                   LGVTTGISAEDRARTIQVAVNPDSLPTDLRRPGHIFPLRARSGGVLQRAGHTESAIDMT
FT                   RLAGLYPAGVICEIQNPDGSMARLPQLKDYAHEHQLKIISIADLISYRLQHERFVHRET
FT                   VADMPTEFGQFQIYAYRNQLDHKEHVAIVKGDPKQFGQQPVMVRMHSECLTGDAIGSLR
FT                   CDCRMQLQAALKMIENVGQGVVVYLRQEGRGIGLVNKLKAYSLQDMGLDTVEANEKLGF
FT                   PADLRNYGVGAQILNDLGIQKIRLITNNPRKIAGLKGYGLEVADRVPLLIEANTYNTTY
FT                   LNTKAEKLGHMLLQTYLMTIAIRWQDEPLDVTQRYDRLEKLRHLADNQHLLLQEEARPV
FT                   AIALFEGPSLICHLGLDQPDVASADWYQQKGHPYREAVTRIFGDLKQDSNVASVEFLIS
FT                   SGTDPLKNLQVKLDRKSIKADQLPLPLCHDLETQTIYSVDLSE"
     MNPHATPTDS FEFDSIEDAL AEFKAGHAIV VVDDENRENE GDLICAAQFA TPDMINFMAV        60
     EARGLICLAM TGERLDALEL PLMVTNNTDM NQTAFTVSID ASPHLGVTTG ISAEDRARTI       120
     QVAVNPDSLP TDLRRPGHIF PLRARSGGVL QRAGHTESAI DMTRLAGLYP AGVICEIQNP       180
     DGSMARLPQL KDYAHEHQLK IISIADLISY RLQHERFVHR ETVADMPTEF GQFQIYAYRN       240
     QLDHKEHVAI VKGDPKQFGQ QPVMVRMHSE CLTGDAIGSL RCDCRMQLQA ALKMIENVGQ       300
     GVVVYLRQEG RGIGLVNKLK AYSLQDMGLD TVEANEKLGF PADLRNYGVG AQILNDLGIQ       360
     KIRLITNNPR KIAGLKGYGL EVADRVPLLI EANTYNTTYL NTKAEKLGHM LLQTYLMTIA       420
     IRWQDEPLDV TQRYDRLEKL RHLADNQHLL LQEEARPVAI ALFEGPSLIC HLGLDQPDVA       480
     SADWYQQKGH PYREAVTRIF GDLKQDSNVA SVEFLISSGT DPLKNLQVKL DRKSIKADQL       540
     PLPLCHDLET QTIYSVDLSE                                                   560
//

If you have problems or comments...

PBIL Back to PBIL home page