(data stored in ACNUC8465 zone)

EMBL: CP000828.RPOE

CP000828.RPOE        Location/Qualifiers
FT   CDS             123317..124237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="AM1_0119"
FT                   /product="RNA polymerase sigma-24 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25206"
FT                   /db_xref="GOA:B0C6B2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014303"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B0C6B2"
FT                   /protein_id="ABW25206.1"
FT                   /translation="MGTQPSAASHPLTDDFLEYRSLLFAIAYRMLGTVMDAEDMVQDTF
FT                   LKWQTVSKSQVRSAKSYLTTIITRLCIDRLRSAQVQREQYIGPWLPEPIVSDLSADPNH
FT                   RVELADSLTMAFLVMLERLSPIERAVFLLREIFDYDYDDIAPIVDKSTVNCRQIARRAR
FT                   QQVTKPRSRFPSSPEQHQQLTLKFMQACQQGEMEDLLQYLADDITLWSDGGGQVTAALK
FT                   PIQGSAKVSGFLRAIYRYQSKLGFTPDLELVQVNGQTGIQFSISGQVETIAVLETTGQQ
FT                   IISIFFIRNPQKLKIEQTHPSSILD"
     MGTQPSAASH PLTDDFLEYR SLLFAIAYRM LGTVMDAEDM VQDTFLKWQT VSKSQVRSAK        60
     SYLTTIITRL CIDRLRSAQV QREQYIGPWL PEPIVSDLSA DPNHRVELAD SLTMAFLVML       120
     ERLSPIERAV FLLREIFDYD YDDIAPIVDK STVNCRQIAR RARQQVTKPR SRFPSSPEQH       180
     QQLTLKFMQA CQQGEMEDLL QYLADDITLW SDGGGQVTAA LKPIQGSAKV SGFLRAIYRY       240
     QSKLGFTPDL ELVQVNGQTG IQFSISGQVE TIAVLETTGQ QIISIFFIRN PQKLKIEQTH       300
     PSSILD                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page