(data stored in ACNUC5340 zone)

EMBL: CP000828.RSGA

CP000828.RSGA        Location/Qualifiers
FT   CDS             399963..401048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsgA"
FT                   /locus_tag="AM1_0425"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25482"
FT                   /db_xref="GOA:B0CAZ2"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:B0CAZ2"
FT                   /protein_id="ABW25482.1"
FT                   /translation="MSKQAQAATDTPLTGTVLAVQANFYQVQLQAAQNFPSSQLLCTRR
FT                   SRLKKLRQQVMVGDQVVVEEPDWLGQRGAIASILPRQSQLARPPIANVNQILLMFALAE
FT                   PKLDPQQLTRFLVTAEQTHLPIILCFNKRDLTTYATQKAWRDRMKRWGYDPILISLQTG
FT                   VGLKALERPLREHITVASGLSGVGKSSLINHFIPDIDLRVGRVSERWGQGRHTTRHVEL
FT                   FELSKGGFLADTPGFNQPSLSNILPAQLGQCFPEIRQRLSQARCQFKDCQHMDEPNCAV
FT                   RGDWERYPYYLNLLAEVTEEHAKRQMTATTEARTKRKSGKRGKIKNEPKLETKRYRRPS
FT                   RRQLQQDLQNIDLDHLEHSSP"
     MSKQAQAATD TPLTGTVLAV QANFYQVQLQ AAQNFPSSQL LCTRRSRLKK LRQQVMVGDQ        60
     VVVEEPDWLG QRGAIASILP RQSQLARPPI ANVNQILLMF ALAEPKLDPQ QLTRFLVTAE       120
     QTHLPIILCF NKRDLTTYAT QKAWRDRMKR WGYDPILISL QTGVGLKALE RPLREHITVA       180
     SGLSGVGKSS LINHFIPDID LRVGRVSERW GQGRHTTRHV ELFELSKGGF LADTPGFNQP       240
     SLSNILPAQL GQCFPEIRQR LSQARCQFKD CQHMDEPNCA VRGDWERYPY YLNLLAEVTE       300
     EHAKRQMTAT TEARTKRKSG KRGKIKNEPK LETKRYRRPS RRQLQQDLQN IDLDHLEHSS       360
     P                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page