(data stored in ACNUC27125 zone)

EMBL: CP000828.SECD

CP000828.SECD        Location/Qualifiers
FT   CDS             complement(91200..92054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="AM1_0085"
FT                   /product="protein-export membrane protein SecD, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25173"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:B0C679"
FT                   /protein_id="ABW25173.1"
FT                   /translation="MLALTTATQCADVDLWSQFPISIPPTVSSTQLCPFQGTELTLRMG
FT                   EAYEDKISREQAFDQVQTVLRERLLNLGQVSVGFIPLPPDQFLIQLPSQLDQRQALQRI
FT                   TQRSHLTFRLHNPTTPQTESLILQKIELQPKLDAKSSDLRQIEKQLAQIYKKLYGPPVL
FT                   TDKNLIDASYQIASVGHLWDVTLRFDAQGAEQFEQITQKMAGTQRPIGFFLDDQLLSEA
FT                   TVSSQFAKTGISGGAAVITGNFDLETAKNLAFQLKEGSLPAPITVLKIEAVQTEQCPST
FT                   PQV"
     MLALTTATQC ADVDLWSQFP ISIPPTVSST QLCPFQGTEL TLRMGEAYED KISREQAFDQ        60
     VQTVLRERLL NLGQVSVGFI PLPPDQFLIQ LPSQLDQRQA LQRITQRSHL TFRLHNPTTP       120
     QTESLILQKI ELQPKLDAKS SDLRQIEKQL AQIYKKLYGP PVLTDKNLID ASYQIASVGH       180
     LWDVTLRFDA QGAEQFEQIT QKMAGTQRPI GFFLDDQLLS EATVSSQFAK TGISGGAAVI       240
     TGNFDLETAK NLAFQLKEGS LPAPITVLKI EAVQTEQCPS TPQV                        284
//

If you have problems or comments...

PBIL Back to PBIL home page