(data stored in ACNUC8465 zone)

EMBL: CP000828.SPHX

CP000828.SPHX        Location/Qualifiers
FT   CDS             complement(168971..169963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sphX"
FT                   /locus_tag="AM1_0168"
FT                   /product="phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25254"
FT                   /db_xref="GOA:B0C7J4"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:B0C7J4"
FT                   /protein_id="ABW25254.1"
FT                   /translation="MQLNRSTLTGAVVSLAVAVSTTAFSATSADAQTKKIKIDGSSTVF
FT                   PISEAVAEEFQKLTNNKVNVTVGVSGTGGGFKKFCAGETDISDASRPIKEKEQKLCEGV
FT                   EYIEIPVAFDALTVVVNKGNPIKSMTVAELKKMWSENPEGSVTTWKEVNSSWPADKISF
FT                   YAPGSDSGTFDYFNGTIAKKNHRKDITASEDDNILVQGVSREPNGIGYFGFAYYEQNKD
FT                   RLNAVAIDNGNGPVLPSREAVENGTYTPLSRPIFIYVNKKAAKRPEVRQFVNYYLRKAA
FT                   EFSAEVGYIPLPAPAYQQAAKNFREGKTGSFFAGRDTDGLKVSEVLKSK"
     MQLNRSTLTG AVVSLAVAVS TTAFSATSAD AQTKKIKIDG SSTVFPISEA VAEEFQKLTN        60
     NKVNVTVGVS GTGGGFKKFC AGETDISDAS RPIKEKEQKL CEGVEYIEIP VAFDALTVVV       120
     NKGNPIKSMT VAELKKMWSE NPEGSVTTWK EVNSSWPADK ISFYAPGSDS GTFDYFNGTI       180
     AKKNHRKDIT ASEDDNILVQ GVSREPNGIG YFGFAYYEQN KDRLNAVAID NGNGPVLPSR       240
     EAVENGTYTP LSRPIFIYVN KKAAKRPEVR QFVNYYLRKA AEFSAEVGYI PLPAPAYQQA       300
     AKNFREGKTG SFFAGRDTDG LKVSEVLKSK                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page