(data stored in ACNUC27125 zone)

EMBL: CP000828.SPPA

CP000828.SPPA        Location/Qualifiers
FT   CDS             complement(9275..10096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sppA"
FT                   /locus_tag="AM1_0011"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25100"
FT                   /db_xref="GOA:B0C4Y8"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B0C4Y8"
FT                   /protein_id="ABW25100.1"
FT                   /translation="MIWPFKGARKQIARLEIKGAIAGATRKHVLEALKTIEEKGYPVLL
FT                   LRIDSPGGTVVDSHEIYSALIKLREKIKIVASFGNISASGGVYIGMGAEHIMANPGTIT
FT                   GSIGVILRGNNLERLLDKVGVSFKVIKSGPYKDILAFDRELTEPERQILQDLIDSSYSQ
FT                   FVEIVAEGRNLEVDAVKQFADGRVFTGQQALELGLVDRLGTEEDARCWAAELAGLDPEK
FT                   AKCNTIEEHKSFWSKLLPGSRQSSWSVPPQVADWVNFEIATNGLPLWLYRP"
     MIWPFKGARK QIARLEIKGA IAGATRKHVL EALKTIEEKG YPVLLLRIDS PGGTVVDSHE        60
     IYSALIKLRE KIKIVASFGN ISASGGVYIG MGAEHIMANP GTITGSIGVI LRGNNLERLL       120
     DKVGVSFKVI KSGPYKDILA FDRELTEPER QILQDLIDSS YSQFVEIVAE GRNLEVDAVK       180
     QFADGRVFTG QQALELGLVD RLGTEEDARC WAAELAGLDP EKAKCNTIEE HKSFWSKLLP       240
     GSRQSSWSVP PQVADWVNFE IATNGLPLWL YRP                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page