(data stored in ACNUC5340 zone)

EMBL: CP000828.THIF

CP000828.THIF        Location/Qualifiers
FT   CDS             304808..305443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiF"
FT                   /locus_tag="AM1_0333"
FT                   /product="ThiF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25392"
FT                   /db_xref="GOA:B0C9V2"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:B0C9V2"
FT                   /protein_id="ABW25392.1"
FT                   /translation="MTEQFFHEQLYRSTQQMAMLRDYPVTVCGAGALGANLVETLARSG
FT                   YGKLKVIDCDRIETRNLSTQPYYRSDVGAYKGKILANMLYRALGTTVDVIPKQLTAANT
FT                   QSLLRGSSLVIDTFDNSVSRQAVKDYCLEQDIPCLHAGLAAEYAEVVWEPEYQVPSATH
FT                   DDICDYPLARNLVLLTVAIASETITRFITEGRQQSCTITLRDFVIHTS"
     MTEQFFHEQL YRSTQQMAML RDYPVTVCGA GALGANLVET LARSGYGKLK VIDCDRIETR        60
     NLSTQPYYRS DVGAYKGKIL ANMLYRALGT TVDVIPKQLT AANTQSLLRG SSLVIDTFDN       120
     SVSRQAVKDY CLEQDIPCLH AGLAAEYAEV VWEPEYQVPS ATHDDICDYP LARNLVLLTV       180
     AIASETITRF ITEGRQQSCT ITLRDFVIHT S                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page