(data stored in ACNUC7421 zone)

EMBL: CP000859.PE101

CP000859.PE101       Location/Qualifiers
FT   CDS             112986..113180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0101"
FT                   /product="protein of unknown function DUF37"
FT                   /note="PFAM: protein of unknown function DUF37; KEGG:
FT                   chy:CHY_0003 conserved hypothetical protein TIGR00278"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65911"
FT                   /db_xref="GOA:A8ZRZ4"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZRZ4"
FT                   /protein_id="ABW65911.1"
FT                   /translation="MILIRAYQLVVSPLLGPRCRFYPSCSQYAHEAVFRHGVVKGLFLS
FT                   IKRIARCHPFCPGGYDPVP"
     MILIRAYQLV VSPLLGPRCR FYPSCSQYAH EAVFRHGVVK GLFLSIKRIA RCHPFCPGGY        60
     DPVP                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page