(data stored in ACNUC7421 zone)

EMBL: CP000859.PE105

CP000859.PE105       Location/Qualifiers
FT   CDS             117620..118303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0105"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   dde:Dde_3774 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65915"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSK2"
FT                   /protein_id="ABW65915.1"
FT                   /translation="MEFDFTPYFTRYEMLVSMVDGIFDRVKDEYPACVTCSQGCSDCCH
FT                   ALFDLTLIEALYINHKFNAAFGRNEQMLEKANRADRQIYKLKKQAYLDHEQGKNEVAIL
FT                   AEMGMERVRCPLLNNEEMCDLYAFRPITCRIYGIPTSISGMSHTCGKSGFEAGGKYPTL
FT                   NMDKIYSQLYALSRELMVDIQTRYTKMDEMLVPVSMALLSDYDDAFFGFNQEAENTEDG
FT                   KEEKE"
     MEFDFTPYFT RYEMLVSMVD GIFDRVKDEY PACVTCSQGC SDCCHALFDL TLIEALYINH        60
     KFNAAFGRNE QMLEKANRAD RQIYKLKKQA YLDHEQGKNE VAILAEMGME RVRCPLLNNE       120
     EMCDLYAFRP ITCRIYGIPT SISGMSHTCG KSGFEAGGKY PTLNMDKIYS QLYALSRELM       180
     VDIQTRYTKM DEMLVPVSMA LLSDYDDAFF GFNQEAENTE DGKEEKE                     227
//

If you have problems or comments...

PBIL Back to PBIL home page