(data stored in ACNUC7421 zone)

EMBL: CP000859.PE110

CP000859.PE110       Location/Qualifiers
FT   CDS             121442..121936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_3937 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65920"
FT                   /db_xref="InterPro:IPR021471"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSK7"
FT                   /protein_id="ABW65920.1"
FT                   /translation="MKTPRCMVRIGMAVLVCLMVFLSTAGAESVLPLSTGQTLYVPAYS
FT                   HIYSGNNEQPFLLTVTLSIRNIDPGRAILVTKADYYATQGKQLKSYVSAPVKLKPLESI
FT                   RYVVPERDKSGGSGANFIVEWTSDGPVNPPIVESIMIGTQIQQGISFTSRGQPITPFSS
FT                   Q"
     MKTPRCMVRI GMAVLVCLMV FLSTAGAESV LPLSTGQTLY VPAYSHIYSG NNEQPFLLTV        60
     TLSIRNIDPG RAILVTKADY YATQGKQLKS YVSAPVKLKP LESIRYVVPE RDKSGGSGAN       120
     FIVEWTSDGP VNPPIVESIM IGTQIQQGIS FTSRGQPITP FSSQ                        164
//

If you have problems or comments...

PBIL Back to PBIL home page