(data stored in ACNUC7421 zone)

EMBL: CP000859.PE118

CP000859.PE118       Location/Qualifiers
FT   CDS             129618..130499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65928"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSL5"
FT                   /protein_id="ABW65928.1"
FT                   /translation="MRPVRQLFLLPFLLLVFASSGLCFTDVTTLEFKGFTLGMSLEQAV
FT                   KTLKARAYRENRDIRVFSSGEYAISAYFQNDIPLHLVSAKESDYTDMTLQFANNELLML
FT                   DAKTRYVTADQARALPDKYTRIFGPFDFRGEKLSRDTAVLFWLWGGESIRPETPPMAPH
FT                   VQVQIISKRENGKETPESEELRMVDVPKLMGVQYAETLEQYLKGNALYAAKVEEGRKLA
FT                   AGHIPKIQAAIDGDDRYRQVKLNPFEDTILVSGVVKQGDLNPLKEMVAATDPPLKITWN
FT                   VREYPAEVFKQK"
     MRPVRQLFLL PFLLLVFASS GLCFTDVTTL EFKGFTLGMS LEQAVKTLKA RAYRENRDIR        60
     VFSSGEYAIS AYFQNDIPLH LVSAKESDYT DMTLQFANNE LLMLDAKTRY VTADQARALP       120
     DKYTRIFGPF DFRGEKLSRD TAVLFWLWGG ESIRPETPPM APHVQVQIIS KRENGKETPE       180
     SEELRMVDVP KLMGVQYAET LEQYLKGNAL YAAKVEEGRK LAAGHIPKIQ AAIDGDDRYR       240
     QVKLNPFEDT ILVSGVVKQG DLNPLKEMVA ATDPPLKITW NVREYPAEVF KQK              293
//

If you have problems or comments...

PBIL Back to PBIL home page