(data stored in ACNUC7421 zone)

EMBL: CP000859.PE119

CP000859.PE119       Location/Qualifiers
FT   CDS             130561..131370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0119"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   cgt:cgR_0687 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65929"
FT                   /db_xref="GOA:A8ZSL6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSL6"
FT                   /protein_id="ABW65929.1"
FT                   /translation="MTSISNNDLLSLGDLNLAEFNREFARWNERYEIIESDDLLMTLGA
FT                   DAFPGANFVMRLAPACTPSANELLDRAMAFFQARQRGFSIHVRRHIDTDLEAACEAAGM
FT                   FKVGNSAGMCLDTPLPDKPEDGSVQVRVIEERQGAVDFADVTVASYKSLGLPEETGKKM
FT                   FAAPERMLKPHIVPVVAYDHGVPVSVAMALMSHGIAGIYWVGTVETHRRRGLAERCTRI
FT                   AGNRAFAMGATRVVLQASHMGEPVYQGMGYREFTRYPWYMWFYKKRG"
     MTSISNNDLL SLGDLNLAEF NREFARWNER YEIIESDDLL MTLGADAFPG ANFVMRLAPA        60
     CTPSANELLD RAMAFFQARQ RGFSIHVRRH IDTDLEAACE AAGMFKVGNS AGMCLDTPLP       120
     DKPEDGSVQV RVIEERQGAV DFADVTVASY KSLGLPEETG KKMFAAPERM LKPHIVPVVA       180
     YDHGVPVSVA MALMSHGIAG IYWVGTVETH RRRGLAERCT RIAGNRAFAM GATRVVLQAS       240
     HMGEPVYQGM GYREFTRYPW YMWFYKKRG                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page