(data stored in ACNUC7421 zone)

EMBL: CP000859.PE120

CP000859.PE120       Location/Qualifiers
FT   CDS             131723..132865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0120"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, small
FT                   subunit; PFAM: glutamine amidotransferase class-I;
FT                   Carbamoyl-phosphate synthase small chain; KEGG: dps:DP3095
FT                   probable carbamoyl-phosphate synthase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65930"
FT                   /db_xref="GOA:A8ZSL7"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSL7"
FT                   /protein_id="ABW65930.1"
FT                   /translation="MKALLALEDGRTFACKSFTGPGETGGEIVFNTGMSGYQEVLTDPS
FT                   YRGQIVTMTYPLIGNYGVNHQDVESDRVQVAGFVVREYQDCPSNFRSEQSLAKYLQSQG
FT                   VLGITDLDTRALTRHLRTVGALRACISTHELDPAALVEKALAVPSMAGCDLVTGVFSKK
FT                   PYRWINGAPAAVDMDLADMDERVWHKTGGFRVAAFDFGIKYNILRNLEAAGFQVLVVPA
FT                   GATAAQVKQVNPDGIFLSNGPGDPEPLTGPVATIRELLDYRPMFGICLGNQLAGLALGG
FT                   ATYKLKFGHRGANQPVKDLETGKIEITSQNHGFAVDIDSLKKENLVVTHINLNDNTLEG
FT                   FAHKDIPLFTVQYHPEASPGPHDARYLFDRFKALIEKTHA"
     MKALLALEDG RTFACKSFTG PGETGGEIVF NTGMSGYQEV LTDPSYRGQI VTMTYPLIGN        60
     YGVNHQDVES DRVQVAGFVV REYQDCPSNF RSEQSLAKYL QSQGVLGITD LDTRALTRHL       120
     RTVGALRACI STHELDPAAL VEKALAVPSM AGCDLVTGVF SKKPYRWING APAAVDMDLA       180
     DMDERVWHKT GGFRVAAFDF GIKYNILRNL EAAGFQVLVV PAGATAAQVK QVNPDGIFLS       240
     NGPGDPEPLT GPVATIRELL DYRPMFGICL GNQLAGLALG GATYKLKFGH RGANQPVKDL       300
     ETGKIEITSQ NHGFAVDIDS LKKENLVVTH INLNDNTLEG FAHKDIPLFT VQYHPEASPG       360
     PHDARYLFDR FKALIEKTHA                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page