(data stored in ACNUC7421 zone)

EMBL: CP000859.PE121

CP000859.PE121       Location/Qualifiers
FT   CDS             132858..136085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dole_0121"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, large
FT                   subunit; PFAM: ATP-dependent carboxylate-amine ligase
FT                   domain protein ATP-grasp; Carbamoyl-phosphate synthase L
FT                   chain ATP-binding; Carbamoyl-phosphate synthetase large
FT                   chain oligomerisation; Carbamoyl-phosphate synthetase large
FT                   chain domain protein; MGS domain protein; RimK domain
FT                   protein ATP-grasp; KEGG: sat:SYN_01625 carbamoyl-phosphate
FT                   synthase large chain"
FT                   /db_xref="EnsemblGenomes-Gn:Dole_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABW65931"
FT                   /db_xref="GOA:A8ZSL8"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A8ZSL8"
FT                   /protein_id="ABW65931.1"
FT                   /translation="MPKRTDIEKILIIGAGPIIISQACEFDYSGTQACKALKEEGYSVV
FT                   LVNSNPATIMTDPEFADATYIEPVTPEAVAAIIEKERPCAILPTLGGQTGLNTAVAVAE
FT                   MGVLEKFNVEMIGASLSAIKKAEDRDLFRKAMNNIGLRIPRSGIATSMDQVRAIADEIG
FT                   LPLIVRPSFTLGGTGGGVAHTQAELDALSAGGLEASLINQVMIEESVVGWKEYELEVMR
FT                   DRADNVVIICSIENLDPMGVHTGESITVAPIQTLSDKEYQVMRDASIAIMREIGVDTGG
FT                   SNVQFAVNPANGEMVVVEMNPRVSRSSALASKATGFPIAKIAAKLAVGYTLDEIANDIT
FT                   GETRAAFEPTLDYCVVKIPRWTFEKFPETKDELSTSMKSVGETMAIGRTFKEALQKGIR
FT                   SLEISRFGLGADGADKIDPSIQEITDKLATPNSERLFYLRYALQKGFTIDDIYRLTRID
FT                   PWFLDQIEKILFVEKTLIEHKDNLSADLLWRAKREGFSDVQLAHITGKTEEEIRALRYE
FT                   AGLRPVYKLVDTCAAEFKAATPYYYSTYETENEARVSDRKKVVILGGGPNRIGQGIEFD
FT                   YCCVHASFALREEGVESIMVNSNPETVSTDYDTSDKLYFEPLTVEDVLHIIDTEKCDGV
FT                   IVQFGGQTPLNIAEALARAGAPIIGTSPESIRRSEDRKFFAAMLSKLGLLQPPNGTAVN
FT                   VEEAAAIAQNLGYPVIVRPSFVLGGRAMKIVYTPAELANFARHAIKASPKHPILVDKFL
FT                   EDAIELDVDAISDTTGHTVIGGIMEHIEEAGIHSGDSACVLPPHSVKPHVIDEIIRATK
FT                   AMAAELKVVGLMNVQYAVKGDTLYVIEVNPRASRTVPFVSKATGVALAKAATKVMLGRT
FT                   LKELGIVDDAWRTAHIAVKEAVFPFNRFPDVDTLLGPEMKSTGEVMGLDMDFGAAFAKA
FT                   QLGAGQKLPVKGNVFISVQDKDKRATAGIARQLSDAGFEIVATAGTAAFLKEQRIAVRP
FT                   INKVSDGHPHVVDAIVNGEIQLVINTGTGQDSQVKRDGYMIRRTTLRCQVPYATTLPGA
FT                   LAVCRGILQLKKQALGVKSIQEYHQKP"
     MPKRTDIEKI LIIGAGPIII SQACEFDYSG TQACKALKEE GYSVVLVNSN PATIMTDPEF        60
     ADATYIEPVT PEAVAAIIEK ERPCAILPTL GGQTGLNTAV AVAEMGVLEK FNVEMIGASL       120
     SAIKKAEDRD LFRKAMNNIG LRIPRSGIAT SMDQVRAIAD EIGLPLIVRP SFTLGGTGGG       180
     VAHTQAELDA LSAGGLEASL INQVMIEESV VGWKEYELEV MRDRADNVVI ICSIENLDPM       240
     GVHTGESITV APIQTLSDKE YQVMRDASIA IMREIGVDTG GSNVQFAVNP ANGEMVVVEM       300
     NPRVSRSSAL ASKATGFPIA KIAAKLAVGY TLDEIANDIT GETRAAFEPT LDYCVVKIPR       360
     WTFEKFPETK DELSTSMKSV GETMAIGRTF KEALQKGIRS LEISRFGLGA DGADKIDPSI       420
     QEITDKLATP NSERLFYLRY ALQKGFTIDD IYRLTRIDPW FLDQIEKILF VEKTLIEHKD       480
     NLSADLLWRA KREGFSDVQL AHITGKTEEE IRALRYEAGL RPVYKLVDTC AAEFKAATPY       540
     YYSTYETENE ARVSDRKKVV ILGGGPNRIG QGIEFDYCCV HASFALREEG VESIMVNSNP       600
     ETVSTDYDTS DKLYFEPLTV EDVLHIIDTE KCDGVIVQFG GQTPLNIAEA LARAGAPIIG       660
     TSPESIRRSE DRKFFAAMLS KLGLLQPPNG TAVNVEEAAA IAQNLGYPVI VRPSFVLGGR       720
     AMKIVYTPAE LANFARHAIK ASPKHPILVD KFLEDAIELD VDAISDTTGH TVIGGIMEHI       780
     EEAGIHSGDS ACVLPPHSVK PHVIDEIIRA TKAMAAELKV VGLMNVQYAV KGDTLYVIEV       840
     NPRASRTVPF VSKATGVALA KAATKVMLGR TLKELGIVDD AWRTAHIAVK EAVFPFNRFP       900
     DVDTLLGPEM KSTGEVMGLD MDFGAAFAKA QLGAGQKLPV KGNVFISVQD KDKRATAGIA       960
     RQLSDAGFEI VATAGTAAFL KEQRIAVRPI NKVSDGHPHV VDAIVNGEIQ LVINTGTGQD      1020
     SQVKRDGYMI RRTTLRCQVP YATTLPGALA VCRGILQLKK QALGVKSIQE YHQKP           1075
//

If you have problems or comments...

PBIL Back to PBIL home page